PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00037.1.g03270.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family SBP
Protein Properties Length: 542aa    MW: 57759.4 Da    PI: 7.0398
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00037.1.g03270.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP126.61e-39250327178
                                   --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                           SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                                   +Cq+egC+adl++ak+yhrrhkvCe h+ka++v++ g++qrfCqqCsrfh l efDe+krsCr+rL +hn+rrrk+++
  Zjn_sc00037.1.g03270.1.am.mk 250 RCQAEGCKADLTTAKHYHRRHKVCEYHAKAAAVAAGGKQQRFCQQCSRFHVLAEFDESKRSCRKRLTEHNRRRRKPAS 327
                                   6**************************************************************************875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.3E-34243312IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.094248325IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.88E-37249328IPR004333Transcription factor, SBP-box
PfamPF031102.1E-30251324IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 542 aa     Download sequence    Send to blast
MCLLPLRDPA LHSSHTHARI ASSLSSVPLL SLAAPQHPEV AMTSNRLMSS TAMSPVTTDV  60
DFAFAPIQPP YLGFFDAGNM PMPSLERPLL GLGHQQHNNH YDDFDCAASF PFQDSSFLLP  120
PTTSLPPAPP LLTMDMAIAP TSPSSMHQMT LPCVPAAELY HPAFGVGSSP FLKREDGPVV  180
DAGGGKIGLN LGRRTYFSTA DVLAVDRLLL TRSRLGGGGG VGAGLGLGLG MAGVLGLGLS  240
APHHHQQPPR CQAEGCKADL TTAKHYHRRH KVCEYHAKAA AVAAGGKQQR FCQQCSRFHV  300
LAEFDESKRS CRKRLTEHNR RRRKPASEQG DKEDSSRPPK RADTISYSRD HKSASPAAAK  360
STAISPNGSG VSCLDMDNNG QMMISSAAAA APTALSLSAL PLGKDGDLDT MLMMRQVHGR  420
RDDEGDEEQQ RFVTSLVLQA QQHHHNGGVG NVLSTLSCSP VPDQHQNGDC NGFFETHQIP  480
YLCPVALLSG DEISSPAINL VSYFAPLYGE QCPAPLDCNP PFPCAASCPV SSFPCAASGP  540
EI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-272513241184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1307324KRSCRKRLTEHNRRRRKP
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002451645.11e-135hypothetical protein SORBIDRAFT_04g005180
SwissprotQ0E3F89e-57SPL5_ORYSJ; Squamosa promoter-binding-like protein 5
TrEMBLC5XW901e-135C5XW90_SORBI; Putative uncharacterized protein Sb04g005180
STRINGSb04g005180.11e-134(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23753593
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G02065.16e-36squamosa promoter binding protein-like 8